PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A05G2447
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 248aa    MW: 27848.5 Da    PI: 9.8328
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A05G2447genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.96.2e-15178226554
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                  +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN++L+k+ +el+k
  Gh_A05G2447 178 RRQKRMIKNRESAARSRARKQAYTNELENKVLRLEEENERLRKR-KELEK 226
                  79****************************************65.55555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1709.6E-15168226No hitNo description
SMARTSM003384.1E-12174242IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.542176221IPR004827Basic-leucine zipper domain
PfamPF001702.0E-12178223IPR004827Basic-leucine zipper domain
CDDcd147071.91E-22178232No hitNo description
SuperFamilySSF579595.0E-10178223No hitNo description
PROSITE patternPS000360181196IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MYGTMLTNQA SLQRQASLSL TGALSKKTVD EVWRDIQQSK NDGEKKSRER QPTLGEMTLE  60
DFLVKAGVVA EASTDGDAGA SIAGVDLSVA PQFAQQGQWM QYPQPQYHHP QQSIMGVYMP  120
SQPMPRPLDL GTAAVMDVSY PENQVPLHSP LMGTLSDTQA SGRKRGASED IVEKNVERRQ  180
KRMIKNRESA ARSRARKQAY TNELENKVLR LEEENERLRK RKELEKLLPS APPPEPKYQL  240
RRTSSAPF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012447401.11e-175PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_012447402.11e-175PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_012447403.11e-175PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_012447404.11e-175PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
SwissprotQ9LES35e-78AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLA0A0B0MB101e-179A0A0B0MB10_G
STRINGPOPTR_0008s01130.11e-134(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM18842883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.13e-55ABA-responsive element binding protein 3